Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
- Autores
- Liggieri, Constanza Silvina; Obregón, Walter David; Trejo, Sebastián Alejandro; Priolo de Lufrano, Nora Silvia
- Año de publicación
- 2009
- Idioma
- inglés
- Tipo de recurso
- artículo
- Estado
- versión publicada
- Descripción
- Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: Km = 0.1634 mM, kcat = 121.48 s-1, and kcat/Km = 7.4 × 105 s-1/mM.
Centro de Investigación de Proteínas Vegetales
Facultad de Ciencias Exactas - Materia
-
Ciencias Exactas
Asclepiadaceae
Asclepias curassavica
cysteine proteinase
latex
laticifers - Nivel de accesibilidad
- acceso abierto
- Condiciones de uso
- http://creativecommons.org/licenses/by-nc-sa/4.0/
- Repositorio
.jpg)
- Institución
- Universidad Nacional de La Plata
- OAI Identificador
- oai:sedici.unlp.edu.ar:10915/82696
Ver los metadatos del registro completo
| id |
SEDICI_c1fe6685a773c0f6a6d0cc9c0a127193 |
|---|---|
| oai_identifier_str |
oai:sedici.unlp.edu.ar:10915/82696 |
| network_acronym_str |
SEDICI |
| repository_id_str |
1329 |
| network_name_str |
SEDICI (UNLP) |
| spelling |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.Liggieri, Constanza SilvinaObregón, Walter DavidTrejo, Sebastián AlejandroPriolo de Lufrano, Nora SilviaCiencias ExactasAsclepiadaceaeAsclepias curassavicacysteine proteinaselatexlaticifersMost of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM.Centro de Investigación de Proteínas VegetalesFacultad de Ciencias Exactas2009info:eu-repo/semantics/articleinfo:eu-repo/semantics/publishedVersionArticulohttp://purl.org/coar/resource_type/c_6501info:ar-repo/semantics/articuloapplication/pdf154-162http://sedici.unlp.edu.ar/handle/10915/82696enginfo:eu-repo/semantics/altIdentifier/issn/1672-9145info:eu-repo/semantics/altIdentifier/doi/10.1093/abbs/gmn018info:eu-repo/semantics/openAccesshttp://creativecommons.org/licenses/by-nc-sa/4.0/Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0)reponame:SEDICI (UNLP)instname:Universidad Nacional de La Platainstacron:UNLP2026-05-13T12:23:29Zoai:sedici.unlp.edu.ar:10915/82696Institucionalhttp://sedici.unlp.edu.ar/Universidad públicaNo correspondehttp://sedici.unlp.edu.ar/oai/snrdalira@sedici.unlp.edu.arArgentinaNo correspondeNo correspondeNo correspondeopendoar:13292026-05-13 12:23:29.886SEDICI (UNLP) - Universidad Nacional de La Platafalse |
| dc.title.none.fl_str_mv |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| title |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| spellingShingle |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. Liggieri, Constanza Silvina Ciencias Exactas Asclepiadaceae Asclepias curassavica cysteine proteinase latex laticifers |
| title_short |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| title_full |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| title_fullStr |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| title_full_unstemmed |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| title_sort |
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. |
| dc.creator.none.fl_str_mv |
Liggieri, Constanza Silvina Obregón, Walter David Trejo, Sebastián Alejandro Priolo de Lufrano, Nora Silvia |
| author |
Liggieri, Constanza Silvina |
| author_facet |
Liggieri, Constanza Silvina Obregón, Walter David Trejo, Sebastián Alejandro Priolo de Lufrano, Nora Silvia |
| author_role |
author |
| author2 |
Obregón, Walter David Trejo, Sebastián Alejandro Priolo de Lufrano, Nora Silvia |
| author2_role |
author author author |
| dc.subject.none.fl_str_mv |
Ciencias Exactas Asclepiadaceae Asclepias curassavica cysteine proteinase latex laticifers |
| topic |
Ciencias Exactas Asclepiadaceae Asclepias curassavica cysteine proteinase latex laticifers |
| dc.description.none.fl_txt_mv |
Most of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM. Centro de Investigación de Proteínas Vegetales Facultad de Ciencias Exactas |
| description |
Most of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM. |
| publishDate |
2009 |
| dc.date.none.fl_str_mv |
2009 |
| dc.type.none.fl_str_mv |
info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Articulo http://purl.org/coar/resource_type/c_6501 info:ar-repo/semantics/articulo |
| format |
article |
| status_str |
publishedVersion |
| dc.identifier.none.fl_str_mv |
http://sedici.unlp.edu.ar/handle/10915/82696 |
| url |
http://sedici.unlp.edu.ar/handle/10915/82696 |
| dc.language.none.fl_str_mv |
eng |
| language |
eng |
| dc.relation.none.fl_str_mv |
info:eu-repo/semantics/altIdentifier/issn/1672-9145 info:eu-repo/semantics/altIdentifier/doi/10.1093/abbs/gmn018 |
| dc.rights.none.fl_str_mv |
info:eu-repo/semantics/openAccess http://creativecommons.org/licenses/by-nc-sa/4.0/ Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0) |
| eu_rights_str_mv |
openAccess |
| rights_invalid_str_mv |
http://creativecommons.org/licenses/by-nc-sa/4.0/ Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0) |
| dc.format.none.fl_str_mv |
application/pdf 154-162 |
| dc.source.none.fl_str_mv |
reponame:SEDICI (UNLP) instname:Universidad Nacional de La Plata instacron:UNLP |
| reponame_str |
SEDICI (UNLP) |
| collection |
SEDICI (UNLP) |
| instname_str |
Universidad Nacional de La Plata |
| instacron_str |
UNLP |
| institution |
UNLP |
| repository.name.fl_str_mv |
SEDICI (UNLP) - Universidad Nacional de La Plata |
| repository.mail.fl_str_mv |
alira@sedici.unlp.edu.ar |
| _version_ |
1865171568540254208 |
| score |
13.141195 |