Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

Autores
Liggieri, Constanza Silvina; Obregón, Walter David; Trejo, Sebastián Alejandro; Priolo de Lufrano, Nora Silvia
Año de publicación
2009
Idioma
inglés
Tipo de recurso
artículo
Estado
versión publicada
Descripción
Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: Km = 0.1634 mM, kcat = 121.48 s-1, and kcat/Km = 7.4 × 105 s-1/mM.
Centro de Investigación de Proteínas Vegetales
Facultad de Ciencias Exactas
Materia
Ciencias Exactas
Asclepiadaceae
Asclepias curassavica
cysteine proteinase
latex
laticifers
Nivel de accesibilidad
acceso abierto
Condiciones de uso
http://creativecommons.org/licenses/by-nc-sa/4.0/
Repositorio
SEDICI (UNLP)
Institución
Universidad Nacional de La Plata
OAI Identificador
oai:sedici.unlp.edu.ar:10915/82696

id SEDICI_c1fe6685a773c0f6a6d0cc9c0a127193
oai_identifier_str oai:sedici.unlp.edu.ar:10915/82696
network_acronym_str SEDICI
repository_id_str 1329
network_name_str SEDICI (UNLP)
spelling Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.Liggieri, Constanza SilvinaObregón, Walter DavidTrejo, Sebastián AlejandroPriolo de Lufrano, Nora SilviaCiencias ExactasAsclepiadaceaeAsclepias curassavicacysteine proteinaselatexlaticifersMost of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM.Centro de Investigación de Proteínas VegetalesFacultad de Ciencias Exactas2009info:eu-repo/semantics/articleinfo:eu-repo/semantics/publishedVersionArticulohttp://purl.org/coar/resource_type/c_6501info:ar-repo/semantics/articuloapplication/pdf154-162http://sedici.unlp.edu.ar/handle/10915/82696enginfo:eu-repo/semantics/altIdentifier/issn/1672-9145info:eu-repo/semantics/altIdentifier/doi/10.1093/abbs/gmn018info:eu-repo/semantics/openAccesshttp://creativecommons.org/licenses/by-nc-sa/4.0/Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0)reponame:SEDICI (UNLP)instname:Universidad Nacional de La Platainstacron:UNLP2026-05-13T12:23:29Zoai:sedici.unlp.edu.ar:10915/82696Institucionalhttp://sedici.unlp.edu.ar/Universidad públicaNo correspondehttp://sedici.unlp.edu.ar/oai/snrdalira@sedici.unlp.edu.arArgentinaNo correspondeNo correspondeNo correspondeopendoar:13292026-05-13 12:23:29.886SEDICI (UNLP) - Universidad Nacional de La Platafalse
dc.title.none.fl_str_mv Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
title Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
spellingShingle Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
Liggieri, Constanza Silvina
Ciencias Exactas
Asclepiadaceae
Asclepias curassavica
cysteine proteinase
latex
laticifers
title_short Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
title_full Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
title_fullStr Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
title_full_unstemmed Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
title_sort Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
dc.creator.none.fl_str_mv Liggieri, Constanza Silvina
Obregón, Walter David
Trejo, Sebastián Alejandro
Priolo de Lufrano, Nora Silvia
author Liggieri, Constanza Silvina
author_facet Liggieri, Constanza Silvina
Obregón, Walter David
Trejo, Sebastián Alejandro
Priolo de Lufrano, Nora Silvia
author_role author
author2 Obregón, Walter David
Trejo, Sebastián Alejandro
Priolo de Lufrano, Nora Silvia
author2_role author
author
author
dc.subject.none.fl_str_mv Ciencias Exactas
Asclepiadaceae
Asclepias curassavica
cysteine proteinase
latex
laticifers
topic Ciencias Exactas
Asclepiadaceae
Asclepias curassavica
cysteine proteinase
latex
laticifers
dc.description.none.fl_txt_mv Most of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM.
Centro de Investigación de Proteínas Vegetales
Facultad de Ciencias Exactas
description Most of the species belonging to <i>Asclepiadaceae</i> family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of <i>Asclepias curassavica</i> L. (<i>Asclepiadaceae</i>). Asclepain cII was the minor proteolytic component in the latex, but showed higher specific activity than asclepain cI, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain cII displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain cII is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The N-terminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-α-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-α-CBZ-l-Gln-p-nitrophenyl ester as substrate: K<SUB>m</SUB> = 0.1634 mM, k<SUB>cat</SUB> = 121.48 s<SUP>-1</SUP>, and k<SUB>cat</SUB>/K<SUB>m</SUB> = 7.4 × 10<SUP>5</SUP> s<SUP>-1</SUP>/mM.
publishDate 2009
dc.date.none.fl_str_mv 2009
dc.type.none.fl_str_mv info:eu-repo/semantics/article
info:eu-repo/semantics/publishedVersion
Articulo
http://purl.org/coar/resource_type/c_6501
info:ar-repo/semantics/articulo
format article
status_str publishedVersion
dc.identifier.none.fl_str_mv http://sedici.unlp.edu.ar/handle/10915/82696
url http://sedici.unlp.edu.ar/handle/10915/82696
dc.language.none.fl_str_mv eng
language eng
dc.relation.none.fl_str_mv info:eu-repo/semantics/altIdentifier/issn/1672-9145
info:eu-repo/semantics/altIdentifier/doi/10.1093/abbs/gmn018
dc.rights.none.fl_str_mv info:eu-repo/semantics/openAccess
http://creativecommons.org/licenses/by-nc-sa/4.0/
Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0)
eu_rights_str_mv openAccess
rights_invalid_str_mv http://creativecommons.org/licenses/by-nc-sa/4.0/
Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0)
dc.format.none.fl_str_mv application/pdf
154-162
dc.source.none.fl_str_mv reponame:SEDICI (UNLP)
instname:Universidad Nacional de La Plata
instacron:UNLP
reponame_str SEDICI (UNLP)
collection SEDICI (UNLP)
instname_str Universidad Nacional de La Plata
instacron_str UNLP
institution UNLP
repository.name.fl_str_mv SEDICI (UNLP) - Universidad Nacional de La Plata
repository.mail.fl_str_mv alira@sedici.unlp.edu.ar
_version_ 1865171568540254208
score 13.141195